Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox1 X Skin's store 5
Flower texture decal skin for Xbox one X Console and 2 Con..
Flower texture decal skin for Xbox one X Console and 2 Con..
$23.00
Flaming Skull decal skin for Xbox one X Console and 2 Cont..
Flaming Skull decal skin for Xbox one X Console and 2 Cont..
$23.00
Far Cry decal skin for Xbox one X Console and 2 Controllers
Far Cry decal skin for Xbox one X Console and 2 Controllers
$23.00
Far Cry decal skin for Xbox one X Console and 2 Controllers
Far Cry decal skin for Xbox one X Console and 2 Controllers
$23.00
Fairy Tail decal skin for Xbox one X Console and 2 Control..
Fairy Tail decal skin for Xbox one X Console and 2 Control..
$23.00
Fairy Tail decal skin for Xbox one X Console and 2 Control..
Fairy Tail decal skin for Xbox one X Console and 2 Control..
$23.00
Dragon Ball decal skin for Xbox one X Console and 2 Contro..
Dragon Ball decal skin for Xbox one X Console and 2 Contro..
$23.00
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
$23.00
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
$23.00
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
$23.00
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
$23.00
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
Diablo 4 decal skin for Xbox one X Console and 2 Controllers
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
Demon Slayer decal skin for Xbox one X Console and 2 Contr..
$23.00
Deep Rock Galactic decal skin for Xbox one X Console and 2..
Deep Rock Galactic decal skin for Xbox one X Console and 2..
$23.00
Deadpool decal skin for Xbox one X Console and 2 Controllers
Deadpool decal skin for Xbox one X Console and 2 Controllers
$23.00
Deadpool decal skin for Xbox one X Console and 2 Controllers
Deadpool decal skin for Xbox one X Console and 2 Controllers
$23.00
Deadpool decal skin for Xbox one X Console and 2 Controllers
Deadpool decal skin for Xbox one X Console and 2 Controllers
$23.00
Deadpool decal skin for Xbox one X Console and 2 Controllers
Deadpool decal skin for Xbox one X Console and 2 Controllers
$23.00
Danganronpa Monokuma decal skin for Xbox one X Console and..
Danganronpa Monokuma decal skin for Xbox one X Console and..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i