Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox Series S skins
Xbox Series S Skin's store
Borderlands 3 decal skin for Xbox Series S Console and 2 C..
Borderlands 3 decal skin for Xbox Series S Console and 2 C..
$23.00
Marble Texture decal skin for Xbox Series S Console and 2 ..
Marble Texture decal skin for Xbox Series S Console and 2 ..
$23.00
Dollar Texture decal skin for Xbox Series S Console and 2 ..
Dollar Texture decal skin for Xbox Series S Console and 2 ..
$23.00
Date A Live decal skin for Xbox Series S Console and 2 Con..
Date A Live decal skin for Xbox Series S Console and 2 Con..
$23.00
Date A Live decal skin for Xbox Series S Console and 2 Con..
Date A Live decal skin for Xbox Series S Console and 2 Con..
$23.00
Date A Live decal skin for Xbox Series S Console and 2 Con..
Date A Live decal skin for Xbox Series S Console and 2 Con..
$23.00
Date A Live decal skin for Xbox Series S Console and 2 Con..
Date A Live decal skin for Xbox Series S Console and 2 Con..
$23.00
Date A Live decal skin for Xbox Series S Console and 2 Con..
Date A Live decal skin for Xbox Series S Console and 2 Con..
$23.00
Date A Live decal skin for Xbox Series S Console and 2 Con..
Date A Live decal skin for Xbox Series S Console and 2 Con..
$23.00
Minecraft decal skin for Xbox Series S Console and 2 Contr..
Minecraft decal skin for Xbox Series S Console and 2 Contr..
$23.00
Maccabi Netanya FC decal skin for Xbox Series S Console an..
Maccabi Netanya FC decal skin for Xbox Series S Console an..
$23.00
Jujutsu Kaisen decal skin for Xbox Series S Console and 2 ..
Jujutsu Kaisen decal skin for Xbox Series S Console and 2 ..
$23.00
Jujutsu Kaisen decal skin for Xbox Series S Console and 2 ..
Jujutsu Kaisen decal skin for Xbox Series S Console and 2 ..
$23.00
Jujutsu Kaisen decal skin for Xbox Series S Console and 2 ..
Jujutsu Kaisen decal skin for Xbox Series S Console and 2 ..
$23.00
Jujutsu Kaisen decal skin for Xbox Series S Console and 2 ..
Jujutsu Kaisen decal skin for Xbox Series S Console and 2 ..
$23.00
Tokyo Avengers decal skin for Xbox Series S Console and 2 ..
Tokyo Avengers decal skin for Xbox Series S Console and 2 ..
$23.00
Tokyo Avengers decal skin for Xbox Series S Console and 2 ..
Tokyo Avengers decal skin for Xbox Series S Console and 2 ..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
Demon Slayer decal skin for Xbox Series S Console and 2 Co..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i