Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Digital New Store
PS5 Digital New Store 1 PS5 Digital New Store 2 PS5 Digital New Store 3
Call of Duty decal skin for PS5 Digital Console and two Co..
Call of Duty decal skin for PS5 Digital Console and two Co..
$25.00
Call of Duty decal skin for PS5 Digital Console and two Co..
Call of Duty decal skin for PS5 Digital Console and two Co..
$25.00
Call of Duty decal skin for PS5 Digital Console and two Co..
Call of Duty decal skin for PS5 Digital Console and two Co..
$25.00
Call of Duty Mobile decal skin for PS5 Digital Console and..
Call of Duty Mobile decal skin for PS5 Digital Console and..
$25.00
Modern Warfare decal skin for PS5 Digital Console and two ..
Modern Warfare decal skin for PS5 Digital Console and two ..
$25.00
Call of Duty decal skin for PS5 Digital Console and two Co..
Call of Duty decal skin for PS5 Digital Console and two Co..
$25.00
COD Black ops 2 decal skin for PS5 Digital Console and two..
COD Black ops 2 decal skin for PS5 Digital Console and two..
$25.00
Black ops Cold War decal skin for PS5 Digital Console and ..
Black ops Cold War decal skin for PS5 Digital Console and ..
$25.00
Black ops Cold War decal skin for PS5 Digital Console and ..
Black ops Cold War decal skin for PS5 Digital Console and ..
$25.00
Black ops Cold War decal skin for PS5 Digital Console and ..
Black ops Cold War decal skin for PS5 Digital Console and ..
$25.00
Black ops Cold War decal skin for PS5 Digital Console and ..
Black ops Cold War decal skin for PS5 Digital Console and ..
$25.00
Black ops Cold War decal skin for PS5 Digital Console and ..
Black ops Cold War decal skin for PS5 Digital Console and ..
$25.00
Black ops Cold War decal skin for PS5 Digital Console and ..
Black ops Cold War decal skin for PS5 Digital Console and ..
$25.00
Black ops Cold War decal skin for PS5 Digital Console and ..
Black ops Cold War decal skin for PS5 Digital Console and ..
$25.00
Black ops Cold War decal skin for PS5 Digital Console and ..
Black ops Cold War decal skin for PS5 Digital Console and ..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Cyberpunk decal skin for PS5 Digital Console and two Contr..
Cyberpunk decal skin for PS5 Digital Console and two Contr..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i